Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
Protein Probable thioesterase TTHA0908 [143152] (1 species) |
Species Thermus thermophilus [TaxId:274] [143153] (1 PDB entry) Uniprot Q5SJV0 1-132 |
Domain d1z54c_: 1z54 C: [124452] automated match to d1z54a1 complexed with gol |
PDB Entry: 1z54 (more details), 2.1 Å
SCOPe Domain Sequences for d1z54c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z54c_ d.38.1.1 (C:) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} esvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelgl tfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraariped iyralsvlh
Timeline for d1z54c_: