SCOP 1.73: Domain d1z54b1: 1z54 B:1-132

Lineage for d1z54b1 (1z54 B:1-132)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.1: 4HBT-like [54638] (16 proteins)
   Pfam PF03061

6. Protein Probable thioesterase TTHA0908 [143152] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143153] (1 PDB entry)

8. Domain d1z54b1: 1z54 B:1-132 [124451]
   automatically matched to 1Z54 A:1-132
   complexed with gol

Details for d1z54b1

PDB Entry: 1z54, 2.1 Å

PDB Description: Crystal structure of a hypothetical protein TT1821 from Thermus thermophilus

PDB Compounds: (B:) probable thioesterase

SCOP Domain Sequences for d1z54b1:

Sequence, based on SEQRES records:

>d1z54b1 d.38.1.1 (B:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}
mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraaripe
diyralsvlhlk

Sequence, based on observed residues (ATOM records):

>d1z54b1 d.38.1.1 (B:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}
mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqveraariped
iyralsvlhlk

Timeline for d1z54b1:

• d1z54b1 is new in SCOP 1.73
  
• d1z54b1 appears in SCOP 1.75
  
• d1z54b1 appears in the current release, SCOPe 2.08, called d1z54b_