Lineage for d1z54b_ (1z54 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. Protein Probable thioesterase TTHA0908 [143152] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [143153] (1 PDB entry)
    Uniprot Q5SJV0 1-132
  8. Domain d1z54b_: 1z54 B: [124451]
    automated match to d1z54a1
    complexed with gol

Details for d1z54b_

PDB Entry: 1z54 (more details), 2.1 Å

PDB Description: Crystal structure of a hypothetical protein TT1821 from Thermus thermophilus
PDB Compounds: (B:) probable thioesterase

SCOPe Domain Sequences for d1z54b_:

Sequence, based on SEQRES records: (download)

>d1z54b_ d.38.1.1 (B:) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}
mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraaripe
diyralsvlhlk

Sequence, based on observed residues (ATOM records): (download)

>d1z54b_ d.38.1.1 (B:) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}
mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqveraariped
iyralsvlhlk

SCOPe Domain Coordinates for d1z54b_ are not available.

Timeline for d1z54b_:

Domains from other chains:
(mouse over for more information)
d1z54a1, d1z54c_, d1z54d_