Lineage for d1z53a_ (1z53 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1496991Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1497010Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 1497011Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (170 PDB entries)
    Uniprot P00431
  8. 1497014Domain d1z53a_: 1z53 A: [124449]
    automated match to d1koka_
    complexed with pp9

Details for d1z53a_

PDB Entry: 1z53 (more details), 1.13 Å

PDB Description: The 1.13 Angstrom Structure of Iron-free Cytochrome c Peroxidase
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d1z53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z53a_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d1z53a_:

Click to download the PDB-style file with coordinates for d1z53a_.
(The format of our PDB-style files is described here.)

Timeline for d1z53a_: