Lineage for d1z52b2 (1z52 B:85-467)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 744944Fold f.8: Aerolisin/ETX pore-forming domain [56972] (1 superfamily)
    3 domains: (1) alpha+beta; (2&3) all-beta
  4. 744945Superfamily f.8.1: Aerolisin/ETX pore-forming domain [56973] (2 families) (S)
  5. 744946Family f.8.1.1: (Pro)aerolysin, pore-forming lobe [56974] (1 protein)
  6. 744947Protein (Pro)aerolysin, pore-forming lobe [56975] (1 species)
    contains the APT module at the N-terminus
  7. 744948Species Aeromonas hydrophila [TaxId:644] [56976] (2 PDB entries)
  8. 744950Domain d1z52b2: 1z52 B:85-467 [124448]
    Other proteins in same PDB: d1z52a1, d1z52b1
    automatically matched to d1prea2
    mutant

Details for d1z52b2

PDB Entry: 1z52 (more details), 2.38 Å

PDB Description: proaerolysin mutant w373l
PDB Compounds: (B:) Aerolysin

SCOP Domain Sequences for d1z52b2:

Sequence, based on SEQRES records: (download)

>d1z52b2 f.8.1.1 (B:85-467) (Pro)aerolysin, pore-forming lobe {Aeromonas hydrophila [TaxId: 644]}
iptlsaldipdgdevdvqwrlvhdsanfikptsylahylgyawvggnhsqyvgedmdvtr
dgdgwvirgnndggcdgyrcgdktaikvsnfaynldpdsfkhgdvtqsdrqlvktvvgwa
vndsdtpqsgydvtlrydtatnwsktntyglsekvttknkfkwplvgetelsieiaanqs
wasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflrw
ggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdlnwtiqqnglst
mqnnlarvlrpvragitgdfsaesqfagnieigapvplaadskvrrarsvdgagqglrle
ipldaqelsglgfnnvslsvtpa

Sequence, based on observed residues (ATOM records): (download)

>d1z52b2 f.8.1.1 (B:85-467) (Pro)aerolysin, pore-forming lobe {Aeromonas hydrophila [TaxId: 644]}
iptlsaldipdgdevdvqwrlvhdsanfikptsylahylgyawvggnhsqyvgedmdvtr
dgdgwvirgnndggcdgyrcgdktaikvsnfaynldpdsfkhgdvtqsdrqlvktvvgwa
vndsdtpqsgydvtlrydtatnwsktntyglsekvttknkfkwplvgetelsieiaanqs
wasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflrw
ggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdlnwtiqqnglst
mqnnlarvlrpvragitgdfsaesqfagnieigapvplalrleipldaqelsglgfnnvs
lsvtpa

SCOP Domain Coordinates for d1z52b2:

Click to download the PDB-style file with coordinates for d1z52b2.
(The format of our PDB-style files is described here.)

Timeline for d1z52b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z52b1