Lineage for d1z52b2 (1z52 B:85-467)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576487Fold f.8: Aerolisin/ETX pore-forming domain [56972] (1 superfamily)
    3 domains: (1) alpha+beta; (2&3) all-beta
  4. 2576488Superfamily f.8.1: Aerolisin/ETX pore-forming domain [56973] (3 families) (S)
  5. 2576489Family f.8.1.1: (Pro)aerolysin, pore-forming lobe [56974] (2 proteins)
    automatically mapped to Pfam PF01117
  6. Protein automated matches [254468] (1 species)
    not a true protein
  7. Species Aeromonas hydrophila [TaxId:644] [255001] (1 PDB entry)
  8. 2576507Domain d1z52b2: 1z52 B:85-467 [124448]
    Other proteins in same PDB: d1z52a1, d1z52b1
    automated match to d1prea2
    mutant

Details for d1z52b2

PDB Entry: 1z52 (more details), 2.38 Å

PDB Description: Proaerolysin Mutant W373L
PDB Compounds: (B:) Aerolysin

SCOPe Domain Sequences for d1z52b2:

Sequence, based on SEQRES records: (download)

>d1z52b2 f.8.1.1 (B:85-467) automated matches {Aeromonas hydrophila [TaxId: 644]}
iptlsaldipdgdevdvqwrlvhdsanfikptsylahylgyawvggnhsqyvgedmdvtr
dgdgwvirgnndggcdgyrcgdktaikvsnfaynldpdsfkhgdvtqsdrqlvktvvgwa
vndsdtpqsgydvtlrydtatnwsktntyglsekvttknkfkwplvgetelsieiaanqs
wasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflrw
ggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdlnwtiqqnglst
mqnnlarvlrpvragitgdfsaesqfagnieigapvplaadskvrrarsvdgagqglrle
ipldaqelsglgfnnvslsvtpa

Sequence, based on observed residues (ATOM records): (download)

>d1z52b2 f.8.1.1 (B:85-467) automated matches {Aeromonas hydrophila [TaxId: 644]}
iptlsaldipdgdevdvqwrlvhdsanfikptsylahylgyawvggnhsqyvgedmdvtr
dgdgwvirgnndggcdgyrcgdktaikvsnfaynldpdsfkhgdvtqsdrqlvktvvgwa
vndsdtpqsgydvtlrydtatnwsktntyglsekvttknkfkwplvgetelsieiaanqs
wasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflrw
ggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdlnwtiqqnglst
mqnnlarvlrpvragitgdfsaesqfagnieigapvplalrleipldaqelsglgfnnvs
lsvtpa

SCOPe Domain Coordinates for d1z52b2:

Click to download the PDB-style file with coordinates for d1z52b2.
(The format of our PDB-style files is described here.)

Timeline for d1z52b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z52b1