Lineage for d1z52b1 (1z52 B:1-84)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608203Species Aeromonas hydrophila [TaxId:644] [255000] (1 PDB entry)
  8. 2608205Domain d1z52b1: 1z52 B:1-84 [124447]
    Other proteins in same PDB: d1z52a2, d1z52b2
    automated match to d3g4na1
    mutant

Details for d1z52b1

PDB Entry: 1z52 (more details), 2.38 Å

PDB Description: proaerolysin mutant w373l
PDB Compounds: (B:) Aerolysin

SCOPe Domain Sequences for d1z52b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z52b1 d.169.1.0 (B:1-84) automated matches {Aeromonas hydrophila [TaxId: 644]}
aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
yngeikpgtasntwcyptnpvtge

SCOPe Domain Coordinates for d1z52b1:

Click to download the PDB-style file with coordinates for d1z52b1.
(The format of our PDB-style files is described here.)

Timeline for d1z52b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z52b2