SCOPe 2.06: Domain d1z52b1: 1z52 B:1-84

Lineage for d1z52b1 (1z52 B:1-84)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Aeromonas hydrophila [TaxId:644] [255000] (1 PDB entry)

8. Domain d1z52b1: 1z52 B:1-84 [124447]
   Other proteins in same PDB: d1z52a2, d1z52b2
   automated match to d3g4na1
   mutant

Details for d1z52b1

PDB Entry: 1z52, 2.38 Å

PDB Description: proaerolysin mutant w373l

PDB Compounds: (B:) Aerolysin

SCOPe Domain Sequences for d1z52b1:

Sequence; same for both SEQRES and ATOM records:

>d1z52b1 d.169.1.0 (B:1-84) automated matches {Aeromonas hydrophila [TaxId: 644]}
aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
yngeikpgtasntwcyptnpvtge

Timeline for d1z52b1:

• d1z52b1 first appeared in SCOP 1.73
  
• d1z52b1 appears in SCOPe 2.05
  
• d1z52b1 appears in SCOPe 2.07
  
• d1z52b1 appears in the current release, SCOPe 2.08