Lineage for d1z52b1 (1z52 B:3-84)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 738278Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (2 proteins)
  6. 738293Protein Proaerolysin, N-terminal domain [56470] (1 species)
  7. 738294Species Aeromonas hydrophila [TaxId:644] [56471] (2 PDB entries)
  8. 738296Domain d1z52b1: 1z52 B:3-84 [124447]
    Other proteins in same PDB: d1z52a2, d1z52b2
    automatically matched to d1prea1
    mutant

Details for d1z52b1

PDB Entry: 1z52 (more details), 2.38 Å

PDB Description: proaerolysin mutant w373l
PDB Compounds: (B:) Aerolysin

SCOP Domain Sequences for d1z52b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z52b1 d.169.1.2 (B:3-84) Proaerolysin, N-terminal domain {Aeromonas hydrophila [TaxId: 644]}
pvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgyn
geikpgtasntwcyptnpvtge

SCOP Domain Coordinates for d1z52b1:

Click to download the PDB-style file with coordinates for d1z52b1.
(The format of our PDB-style files is described here.)

Timeline for d1z52b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z52b2