Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Aeromonas hydrophila [TaxId:644] [255000] (1 PDB entry) |
Domain d1z52a1: 1z52 A:3-84 [124445] Other proteins in same PDB: d1z52a2, d1z52b2 automated match to d3g4na1 mutant |
PDB Entry: 1z52 (more details), 2.38 Å
SCOPe Domain Sequences for d1z52a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z52a1 d.169.1.0 (A:3-84) automated matches {Aeromonas hydrophila [TaxId: 644]} pvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgyn geikpgtasntwcyptnpvtge
Timeline for d1z52a1: