Lineage for d1z4ra1 (1z4r A:497-658)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2574995Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2575033Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species)
  7. 2575037Species Human (Homo sapiens) [TaxId:9606] [143647] (1 PDB entry)
    Uniprot Q92830 497-658
  8. 2575038Domain d1z4ra1: 1z4r A:497-658 [124444]
    Other proteins in same PDB: d1z4ra2
    complexed with aco

Details for d1z4ra1

PDB Entry: 1z4r (more details), 1.74 Å

PDB Description: Human GCN5 Acetyltransferase
PDB Compounds: (A:) General control of amino acid synthesis protein 5-like 2

SCOPe Domain Sequences for d1z4ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
giiefhvignsltpkanrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikd
grviggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyade
yaigyfkkqgfskdikvpksrylgyikdyegatlmecelnpr

SCOPe Domain Coordinates for d1z4ra1:

Click to download the PDB-style file with coordinates for d1z4ra1.
(The format of our PDB-style files is described here.)

Timeline for d1z4ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z4ra2