Lineage for d1z4qa1 (1z4q A:34-227)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712365Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (1 protein)
    the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
  6. 712366Protein 5'(3')-deoxyribonucleotidase (dNT-2) [82383] (1 species)
  7. 712367Species Human (Homo sapiens) [TaxId:9606] [82384] (10 PDB entries)
  8. 712377Domain d1z4qa1: 1z4q A:34-227 [124443]
    automatically matched to 1Z4I A:34-227
    complexed with d4m, mg; mutant

Details for d1z4qa1

PDB Entry: 1z4q (more details), 2.05 Å

PDB Description: structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with 2',3'-dideoxy-2',3- didehydrothymidine 5'-monophosphate (d4t-mp)
PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase

SCOP Domain Sequences for d1z4qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4qa1 c.108.1.8 (A:34-227) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
waddwkaildskrp

SCOP Domain Coordinates for d1z4qa1:

Click to download the PDB-style file with coordinates for d1z4qa1.
(The format of our PDB-style files is described here.)

Timeline for d1z4qa1: