SCOP 1.73: Domain d1z4qa1: 1z4q A:34-227

Lineage for d1z4qa1 (1z4q A:34-227)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (1 protein)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP

6. Protein 5'(3')-deoxyribonucleotidase (dNT-2) [82383] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82384] (10 PDB entries)

8. Domain d1z4qa1: 1z4q A:34-227 [124443]
   automatically matched to 1Z4I A:34-227
   complexed with d4m, mg; mutant

Details for d1z4qa1

PDB Entry: 1z4q, 2.05 Å

PDB Description: structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with 2',3'-dideoxy-2',3- didehydrothymidine 5'-monophosphate (d4t-mp)

PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase

SCOP Domain Sequences for d1z4qa1:

Sequence; same for both SEQRES and ATOM records:

>d1z4qa1 c.108.1.8 (A:34-227) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
waddwkaildskrp

Timeline for d1z4qa1:

• d1z4qa1 is new in SCOP 1.73
  
• d1z4qa1 appears in SCOP 1.75
  
• d1z4qa1 appears in the current release, SCOPe 2.08, called d1z4qa_