![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (23 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (1 protein) the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP |
![]() | Protein 5'(3')-deoxyribonucleotidase (dNT-2) [82383] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82384] (10 PDB entries) |
![]() | Domain d1z4qa1: 1z4q A:34-227 [124443] automatically matched to 1Z4I A:34-227 complexed with d4m, mg; mutant |
PDB Entry: 1z4q (more details), 2.05 Å
SCOP Domain Sequences for d1z4qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z4qa1 c.108.1.8 (A:34-227) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs waddwkaildskrp
Timeline for d1z4qa1: