Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins) the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP automatically mapped to Pfam PF06941 |
Protein automated matches [190171] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186899] (19 PDB entries) |
Domain d1z4qa_: 1z4q A: [124443] automated match to d1q92a_ complexed with d4m, mg |
PDB Entry: 1z4q (more details), 2.05 Å
SCOPe Domain Sequences for d1z4qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z4qa_ c.108.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs waddwkaildskrp
Timeline for d1z4qa_: