Lineage for d1z4px_ (1z4p X:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491135Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
    the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
    automatically mapped to Pfam PF06941
  6. 2491142Protein automated matches [190171] (2 species)
    not a true protein
  7. 2491143Species Human (Homo sapiens) [TaxId:9606] [186899] (19 PDB entries)
  8. 2491160Domain d1z4px_: 1z4p X: [124442]
    automated match to d1q92a_
    complexed with dgp, mg

Details for d1z4px_

PDB Entry: 1z4p (more details), 2 Å

PDB Description: Structure of the D41N variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyriboguanosine 5'-monophosphate
PDB Compounds: (X:) 5'(3')-deoxyribonucleotidase

SCOPe Domain Sequences for d1z4px_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4px_ c.108.1.8 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
waddwkaildskrp

SCOPe Domain Coordinates for d1z4px_:

Click to download the PDB-style file with coordinates for d1z4px_.
(The format of our PDB-style files is described here.)

Timeline for d1z4px_: