Lineage for d1z4oa1 (1z4o A:1-219)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848034Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (9 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 848035Protein beta-Phosphoglucomutase [75174] (1 species)
  7. 848036Species Lactococcus lactis [TaxId:1358] [75175] (6 PDB entries)
  8. 848040Domain d1z4oa1: 1z4o A:1-219 [124440]
    automatically matched to d1lvha_
    complexed with gl1, mg

Details for d1z4oa1

PDB Entry: 1z4o (more details), 1.9 Å

PDB Description: structure of beta-phosphoglucomutase with inhibitor bound alpha- galactose 1-phosphate
PDB Compounds: (A:) beta-phosphoglucomutase

SCOP Domain Sequences for d1z4oa1:

Sequence, based on SEQRES records: (download)

>d1z4oa1 c.108.1.6 (A:1-219) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqk

Sequence, based on observed residues (ATOM records): (download)

>d1z4oa1 c.108.1.6 (A:1-219) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpavaaskpapdifiaaahavgvapsesigledsqagiqaikds
galpigvgrpedlgddivivpdtshytleflkevwlqk

SCOP Domain Coordinates for d1z4oa1:

Click to download the PDB-style file with coordinates for d1z4oa1.
(The format of our PDB-style files is described here.)

Timeline for d1z4oa1: