SCOPe 2.08: Domain d1z4ja_: 1z4j A:

Lineage for d1z4ja_ (1z4j A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
   automatically mapped to Pfam PF06941

6. Protein automated matches [190171] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186899] (19 PDB entries)

8. Domain d1z4ja_: 1z4j A: [124434]
   automated match to d1q92a_
   complexed with gol, mg, u2p

Details for d1z4ja_

PDB Entry: 1z4j, 1.8 Å

PDB Description: structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 2'-monophosphate

PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase

SCOPe Domain Sequences for d1z4ja_:

Sequence; same for both SEQRES and ATOM records:

>d1z4ja_ c.108.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
waddwkaildskrp

Timeline for d1z4ja_:

• d1z4ja_ first appeared in SCOP 1.73, called d1z4ja1
  
• d1z4ja_ appears in SCOPe 2.07