![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins) the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP automatically mapped to Pfam PF06941 |
![]() | Protein 5'(3')-deoxyribonucleotidase (dNT-2) [82383] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82384] (4 PDB entries) |
![]() | Domain d1z4ia1: 1z4i A:34-227 [124433] complexed with gol, mg, ump |
PDB Entry: 1z4i (more details), 1.98 Å
SCOPe Domain Sequences for d1z4ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z4ia1 c.108.1.8 (A:34-227) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs waddwkaildskrp
Timeline for d1z4ia1: