Lineage for d1z4eb_ (1z4e B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2574995Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2575345Protein Transcriptional regulator BH1968 [143658] (1 species)
  7. 2575346Species Bacillus halodurans [TaxId:86665] [143659] (1 PDB entry)
    Uniprot Q9KBG0 4-153
  8. 2575348Domain d1z4eb_: 1z4e B: [124432]
    automated match to d1z4ea1

Details for d1z4eb_

PDB Entry: 1z4e (more details), 2 Å

PDB Description: crystal structure of transcriptional regulator from bacillus halodurans c-125
PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d1z4eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4eb_ d.108.1.1 (B:) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]}
hvtireategdleqmvhmladdvlgrkreryekplpvsyvrafkeikkdknnelivacng
eeivgmlqvtftpyltyqgswratiegvrthsaargqgigsqlvcwaierakergchliq
lttdkqrpdalrfyeqlgfkasheglkmhf

SCOPe Domain Coordinates for d1z4eb_:

Click to download the PDB-style file with coordinates for d1z4eb_.
(The format of our PDB-style files is described here.)

Timeline for d1z4eb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z4ea1