Lineage for d1z48b1 (1z48 B:2-338)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681629Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 681630Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 681805Protein NADPH dehydrogenase NamA [141763] (1 species)
    OYE homolog
  7. 681806Species Bacillus subtilis [TaxId:1423] [141764] (4 PDB entries)
    probable NADH-dependent flavin oxidoreductase YqjM
  8. 681812Domain d1z48b1: 1z48 B:2-338 [124430]
    automatically matched to 1Z41 A:2-338
    complexed with fmn

Details for d1z48b1

PDB Entry: 1z48 (more details), 1.8 Å

PDB Description: Crystal structure of reduced YqjM from Bacillus subtilis
PDB Compounds: (B:) Probable NADH-dependent flavin oxidoreductase yqjM

SCOP Domain Sequences for d1z48b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z48b1 c.1.4.1 (B:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]}
arklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliiveas
avnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifapsa
iafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsnh
rtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmkeq
gvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngra
dlifigrellrdpffartaakqlnteipapvqyergw

SCOP Domain Coordinates for d1z48b1:

Click to download the PDB-style file with coordinates for d1z48b1.
(The format of our PDB-style files is described here.)

Timeline for d1z48b1: