Lineage for d1z45a2 (1z45 A:11-357)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (4 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141872] (1 PDB entry)
    Uniprot P04397 11-357
    N-terminal domain of bifunctional Gal10 protein
  8. Domain d1z45a2: 1z45 A:11-357 [124428]
    Other proteins in same PDB: d1z45a1
    complexed with gal, na, nad, upg

Details for d1z45a2

PDB Entry: 1z45 (more details), 1.85 Å

PDB Description: crystal structure of the gal10 fusion protein galactose mutarotase/udp-galactose 4-epimerase from saccharomyces cerevisiae complexed with nad, udp-glucose, and galactose
PDB Compounds: (A:) GAL10 bifunctional protein

SCOPe Domain Sequences for d1z45a2:

Sequence, based on SEQRES records: (download)

>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
skivlvtggagyigshtvveliengydcvvadnlsnstydsvarlevltkhhipfyevdl
cdrkglekvfkeykidsvihfaglkavgestqiplryyhnnilgtvvllelmqqynvskf
vfsssatvygdatrfpnmipipeecplgptnpyghtkyaienilndlynsdkkswkfail
ryfnpigahpsgligedplgipnnllpymaqvavgrreklyifgddydsrdgtpirdyih
vvdlakghiaalqyleayneneglcrewnlgsgkgstvfevyhafckasgidlpykvtgr
ragdvlnltakpdrakrelkwqtelqvedsckdlwkwttenpfgyql

Sequence, based on observed residues (ATOM records): (download)

>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
skivlvtggagyigshtvveliengydcvvadnlsnstydsvarlevltkhhipfyevdl
cdrkglekvfkeykidsvihfaglkavgestqiplryyhnnilgtvvllelmqqynvskf
vfsssatvygdatrfpnmipipeecplgptnpyghtkyaienilndlynsdkkswkfail
ryfnpigahpsgligedplgipnnllpymaqvavgrreklyifrdgtpirdyihvvdlak
ghiaalqyleayneneglcrewnlgsgkgstvfevyhafckasgidlpyvlnltakpdra
krelkwqtelqvedsckdlwkwttenpfgyql

SCOPe Domain Coordinates for d1z45a2 are not available.

Timeline for d1z45a2:

Domains from same chain:
(mouse over for more information)
d1z45a1