Lineage for d1z45a1 (1z45 A:358-699)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391546Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
    automatically mapped to Pfam PF01263
  6. 2391551Protein Galactose mutarotase [74912] (3 species)
  7. 2391552Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141173] (1 PDB entry)
    Uniprot P04397 358-699
    C-terminal domain of Gal10 bifunctional protein
  8. 2391553Domain d1z45a1: 1z45 A:358-699 [124427]
    Other proteins in same PDB: d1z45a2
    complexed with gal, na, nad, upg

Details for d1z45a1

PDB Entry: 1z45 (more details), 1.85 Å

PDB Description: crystal structure of the gal10 fusion protein galactose mutarotase/udp-galactose 4-epimerase from saccharomyces cerevisiae complexed with nad, udp-glucose, and galactose
PDB Compounds: (A:) GAL10 bifunctional protein

SCOPe Domain Sequences for d1z45a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z45a1 b.30.5.4 (A:358-699) Galactose mutarotase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rgvearfsaedmrydarfvtigagtrfqatfanlgasivdlkvngqsvvlgyeneegyln
pdsayigatigryanriskgkfslcnkdyqltvnngvnanhssigsfhrkrflgpiiqnp
skdvftaeymlidnekdtefpgdllvtiqytvnvaqksleivykgkltageatpinltnh
syfnlnkpygdtiegteimvrskksvdvdknmiptgnivdreiatfnstkptvlgpknpq
fdccfvvdenakpsqintlnneltlivkafhpdsnitlevlsteptyqfytgdflsagye
arqgfaiepgryidainqenwkdcvtlkngetygskivyrfs

SCOPe Domain Coordinates for d1z45a1:

Click to download the PDB-style file with coordinates for d1z45a1.
(The format of our PDB-style files is described here.)

Timeline for d1z45a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z45a2