SCOPe 2.07: Domain d1z44b_: 1z44 B:

Lineage for d1z44b_ (1z44 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein NADPH dehydrogenase NamA [141763] (1 species)
   OYE homolog

7. Species Bacillus subtilis [TaxId:1423] [141764] (4 PDB entries)
   Uniprot P54550 1-337
   probable NADH-dependent flavin oxidoreductase YqjM

8. Domain d1z44b_: 1z44 B: [124426]
   automated match to d1z41a1
   complexed with fmn, npo, so4

Details for d1z44b_

PDB Entry: 1z44, 1.4 Å

PDB Description: Crystal structure of oxidized YqjM from Bacillus subtilis complexed with p-nitrophenol

PDB Compounds: (B:) Probable NADH-dependent flavin oxidoreductase yqjM

SCOPe Domain Sequences for d1z44b_:

Sequence; same for both SEQRES and ATOM records:

>d1z44b_ c.1.4.1 (B:) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]}
arklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliiveas
avnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifapsa
iafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsnh
rtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmkeq
gvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngra
dlifigrellrdpffartaakqlnteipapvqyergw

Timeline for d1z44b_:

• d1z44b_ first appeared in SCOP 1.73, called d1z44b1
  
• d1z44b_ appears in SCOPe 2.06
  
• d1z44b_ appears in the current release, SCOPe 2.08