![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
![]() | Protein NADPH dehydrogenase NamA [141763] (1 species) OYE homolog |
![]() | Species Bacillus subtilis [TaxId:1423] [141764] (4 PDB entries) Uniprot P54550 1-337 probable NADH-dependent flavin oxidoreductase YqjM |
![]() | Domain d1z44a_: 1z44 A: [124425] automated match to d1z41a1 complexed with fmn, npo, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1z44 (more details), 1.4 Å
SCOPe Domain Sequences for d1z44a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z44a_ c.1.4.1 (A:) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} arklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliiveas avnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifapsa iafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsnh rtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmkeq gvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngra dlifigrellrdpffartaakqlnteipapvqyergw
Timeline for d1z44a_: