SCOP 1.75: Domain d1z42b1: 1z42 B:2-338

Lineage for d1z42b1 (1z42 B:2-338)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)

6. Protein NADPH dehydrogenase NamA [141763] (1 species)
   OYE homolog

7. Species Bacillus subtilis [TaxId:1423] [141764] (4 PDB entries)
   Uniprot P54550 1-337
   probable NADH-dependent flavin oxidoreductase YqjM

8. Domain d1z42b1: 1z42 B:2-338 [124424]
   automatically matched to 1Z41 A:2-338
   complexed with fmn, hba, so4

Details for d1z42b1

PDB Entry: 1z42, 1.85 Å

PDB Description: Crystal structure of oxidized YqjM from Bacillus subtilis complexed with p-hydroxybenzaldehyde

PDB Compounds: (B:) Probable NADH-dependent flavin oxidoreductase yqjM

SCOP Domain Sequences for d1z42b1:

Sequence; same for both SEQRES and ATOM records:

>d1z42b1 c.1.4.1 (B:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]}
arklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliiveas
avnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifapsa
iafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsnh
rtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmkeq
gvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngra
dlifigrellrdpffartaakqlnteipapvqyergw

Timeline for d1z42b1:

• d1z42b1 first appeared in SCOP 1.73
  
• d1z42b1 is called d1z42b_ in SCOPe 2.01
  
• d1z42b1 appears in the current release, SCOPe 2.08, called d1z42b_