Lineage for d1z42a_ (1z42 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2436513Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2436864Protein NADPH dehydrogenase NamA [141763] (1 species)
    OYE homolog
  7. 2436865Species Bacillus subtilis [TaxId:1423] [141764] (4 PDB entries)
    Uniprot P54550 1-337
    probable NADH-dependent flavin oxidoreductase YqjM
  8. 2436872Domain d1z42a_: 1z42 A: [124423]
    automated match to d1z41a1
    complexed with fmn, hba, so4

Details for d1z42a_

PDB Entry: 1z42 (more details), 1.85 Å

PDB Description: Crystal structure of oxidized YqjM from Bacillus subtilis complexed with p-hydroxybenzaldehyde
PDB Compounds: (A:) Probable NADH-dependent flavin oxidoreductase yqjM

SCOPe Domain Sequences for d1z42a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z42a_ c.1.4.1 (A:) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]}
arklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliiveas
avnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifapsa
iafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsnh
rtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmkeq
gvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngra
dlifigrellrdpffartaakqlnteipapvqyergw

SCOPe Domain Coordinates for d1z42a_:

Click to download the PDB-style file with coordinates for d1z42a_.
(The format of our PDB-style files is described here.)

Timeline for d1z42a_: