Lineage for d1z42a1 (1z42 A:2-338)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681629Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 681630Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 681805Protein NADPH dehydrogenase NamA [141763] (1 species)
    OYE homolog
  7. 681806Species Bacillus subtilis [TaxId:1423] [141764] (4 PDB entries)
    probable NADH-dependent flavin oxidoreductase YqjM
  8. 681813Domain d1z42a1: 1z42 A:2-338 [124423]
    automatically matched to 1Z41 A:2-338
    complexed with fmn, hba, so4

Details for d1z42a1

PDB Entry: 1z42 (more details), 1.85 Å

PDB Description: Crystal structure of oxidized YqjM from Bacillus subtilis complexed with p-hydroxybenzaldehyde
PDB Compounds: (A:) Probable NADH-dependent flavin oxidoreductase yqjM

SCOP Domain Sequences for d1z42a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z42a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]}
arklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliiveas
avnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifapsa
iafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsnh
rtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmkeq
gvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngra
dlifigrellrdpffartaakqlnteipapvqyergw

SCOP Domain Coordinates for d1z42a1:

Click to download the PDB-style file with coordinates for d1z42a1.
(The format of our PDB-style files is described here.)

Timeline for d1z42a1: