Lineage for d1z41b_ (1z41 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828198Protein NADPH dehydrogenase NamA [141763] (1 species)
    OYE homolog
  7. 2828199Species Bacillus subtilis [TaxId:1423] [141764] (4 PDB entries)
    Uniprot P54550 1-337
    probable NADH-dependent flavin oxidoreductase YqjM
  8. 2828201Domain d1z41b_: 1z41 B: [124422]
    automated match to d1z41a1
    complexed with fmn, so4

    has additional insertions and/or extensions that are not grouped together

Details for d1z41b_

PDB Entry: 1z41 (more details), 1.3 Å

PDB Description: Crystal structure of oxidized YqjM from Bacillus subtilis
PDB Compounds: (B:) Probable NADH-dependent flavin oxidoreductase yqjM

SCOPe Domain Sequences for d1z41b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z41b_ c.1.4.1 (B:) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]}
arklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliiveas
avnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifapsa
iafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsnh
rtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmkeq
gvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngra
dlifigrellrdpffartaakqlnteipapvqyergw

SCOPe Domain Coordinates for d1z41b_:

Click to download the PDB-style file with coordinates for d1z41b_.
(The format of our PDB-style files is described here.)

Timeline for d1z41b_: