Lineage for d1z3ya2 (1z3y A:88-235)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351456Fold a.261: GUN4-like [140868] (1 superfamily)
    multihelical; open array, trapping inside an extended region before the C-terminal helix
  4. 2351457Superfamily a.261.1: GUN4-like [140869] (1 family) (S)
    automatically mapped to Pfam PF05419
  5. 2351458Family a.261.1.1: GUN4-like [140870] (2 proteins)
    Pfam PF05419
  6. 2351459Protein GUN4-like protein Ycf53 [140873] (1 species)
  7. 2351460Species Thermosynechococcus elongatus [TaxId:146786] [140874] (2 PDB entries)
    Uniprot Q8DIJ1 88-235
  8. 2351462Domain d1z3ya2: 1z3y A:88-235 [124419]
    Other proteins in same PDB: d1z3ya1, d1z3ya3

Details for d1z3ya2

PDB Entry: 1z3y (more details), 1.7 Å

PDB Description: structure of gun4-1 from thermosynechococcus elongatus
PDB Compounds: (A:) putative cytidyltransferase

SCOPe Domain Sequences for d1z3ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3ya2 a.261.1.1 (A:88-235) GUN4-like protein Ycf53 {Thermosynechococcus elongatus [TaxId: 146786]}
iplrsdrgvdyqelaklfvaekfeaadrlttqklcelagplaqkrrwlyfteveqlpipd
lqtidqlwlafslgrfgysvqrqlwlgcgqnwdrlwekigwrqgkrwprypnefiwdlsa
prghlpltnqlrgvqvlnallnhpawta

SCOPe Domain Coordinates for d1z3ya2:

Click to download the PDB-style file with coordinates for d1z3ya2.
(The format of our PDB-style files is described here.)

Timeline for d1z3ya2: