SCOPe 2.07: Domain d1z3ya1: 1z3y A:1-87

Lineage for d1z3ya1 (1z3y A:1-87)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.22: GUN4-associated domain [140825] (2 proteins)
   PfamB PB089177
   this is a repeat family; one repeat unit is 1z3x A:34-71 found in domain

6. Protein GUN4-like protein Ycf53, N-terminal domain [140828] (1 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [140829] (2 PDB entries)
   Uniprot Q8DIJ1 1-87

8. Domain d1z3ya1: 1z3y A:1-87 [124418]
   Other proteins in same PDB: d1z3ya2, d1z3ya3

Details for d1z3ya1

PDB Entry: 1z3y, 1.7 Å

PDB Description: structure of gun4-1 from thermosynechococcus elongatus

PDB Compounds: (A:) putative cytidyltransferase

SCOPe Domain Sequences for d1z3ya1:

Sequence, based on SEQRES records:

>d1z3ya1 a.118.1.22 (A:1-87) GUN4-like protein Ycf53, N-terminal domain {Thermosynechococcus elongatus [TaxId: 146786]}
mvttepaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppapwir
gqayrllfhspeasvqaflqqhypqgv

Sequence, based on observed residues (ATOM records):

>d1z3ya1 a.118.1.22 (A:1-87) GUN4-like protein Ycf53, N-terminal domain {Thermosynechococcus elongatus [TaxId: 146786]}
mvtpaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppapwirgq
ayrllfhspeasvqaflqqhypqgv

Timeline for d1z3ya1:

• d1z3ya1 first appeared in SCOP 1.73
  
• d1z3ya1 appears in SCOPe 2.06
  
• d1z3ya1 appears in the current release, SCOPe 2.08