Lineage for d1z3ya1 (1z3y A:1-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725991Family a.118.1.22: GUN4-associated domain [140825] (2 proteins)
    PfamB PB089177
    this is a repeat family; one repeat unit is 1z3x A:34-71 found in domain
  6. 2725992Protein GUN4-like protein Ycf53, N-terminal domain [140828] (1 species)
  7. 2725993Species Thermosynechococcus elongatus [TaxId:146786] [140829] (2 PDB entries)
    Uniprot Q8DIJ1 1-87
  8. 2725995Domain d1z3ya1: 1z3y A:1-87 [124418]
    Other proteins in same PDB: d1z3ya2, d1z3ya3

Details for d1z3ya1

PDB Entry: 1z3y (more details), 1.7 Å

PDB Description: structure of gun4-1 from thermosynechococcus elongatus
PDB Compounds: (A:) putative cytidyltransferase

SCOPe Domain Sequences for d1z3ya1:

Sequence, based on SEQRES records: (download)

>d1z3ya1 a.118.1.22 (A:1-87) GUN4-like protein Ycf53, N-terminal domain {Thermosynechococcus elongatus [TaxId: 146786]}
mvttepaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppapwir
gqayrllfhspeasvqaflqqhypqgv

Sequence, based on observed residues (ATOM records): (download)

>d1z3ya1 a.118.1.22 (A:1-87) GUN4-like protein Ycf53, N-terminal domain {Thermosynechococcus elongatus [TaxId: 146786]}
mvtpaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppapwirgq
ayrllfhspeasvqaflqqhypqgv

SCOPe Domain Coordinates for d1z3ya1:

Click to download the PDB-style file with coordinates for d1z3ya1.
(The format of our PDB-style files is described here.)

Timeline for d1z3ya1: