Lineage for d1z3xa1 (1z3x A:1-87)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339064Family a.118.1.22: GUN4-associated domain [140825] (2 proteins)
    PfamB PB089177
    this is a repeat family; one repeat unit is 1z3x A:34-71 found in domain
  6. 2339065Protein GUN4-like protein Ycf53, N-terminal domain [140828] (1 species)
  7. 2339066Species Thermosynechococcus elongatus [TaxId:146786] [140829] (2 PDB entries)
    Uniprot Q8DIJ1 1-87
  8. 2339067Domain d1z3xa1: 1z3x A:1-87 [124416]
    Other proteins in same PDB: d1z3xa2, d1z3xa3

Details for d1z3xa1

PDB Entry: 1z3x (more details), 1.5 Å

PDB Description: Structure of Gun4 from Thermosynechococcus elongatus
PDB Compounds: (A:) putative cytidyltransferase

SCOPe Domain Sequences for d1z3xa1:

Sequence, based on SEQRES records: (download)

>d1z3xa1 a.118.1.22 (A:1-87) GUN4-like protein Ycf53, N-terminal domain {Thermosynechococcus elongatus [TaxId: 146786]}
mvttepaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppapwir
gqayrllfhspeasvqaflqqhypqgv

Sequence, based on observed residues (ATOM records): (download)

>d1z3xa1 a.118.1.22 (A:1-87) GUN4-like protein Ycf53, N-terminal domain {Thermosynechococcus elongatus [TaxId: 146786]}
mvtpaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppapwirgq
ayrllfhspeasvqaflqqhypqgv

SCOPe Domain Coordinates for d1z3xa1:

Click to download the PDB-style file with coordinates for d1z3xa1.
(The format of our PDB-style files is described here.)

Timeline for d1z3xa1: