SCOP 1.73: Domain d1z3xa1: 1z3x A:1-87

Lineage for d1z3xa1 (1z3x A:1-87)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (22 families)

5. Family a.118.1.22: GUN4-associated domain [140825] (2 proteins)
   PfamB 089177
   this is a repeat family; one repeat unit is 1z3x A:34-71 found in domain

6. Protein GUN4-like protein Ycf53, N-terminal domain [140828] (1 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [140829] (2 PDB entries)

8. Domain d1z3xa1: 1z3x A:1-87 [124416]
   Other proteins in same PDB: d1z3xa2

Details for d1z3xa1

PDB Entry: 1z3x, 1.5 Å

PDB Description: Structure of Gun4 from Thermosynechococcus elongatus

PDB Compounds: (A:) putative cytidyltransferase

SCOP Domain Sequences for d1z3xa1:

Sequence, based on SEQRES records:

>d1z3xa1 a.118.1.22 (A:1-87) GUN4-like protein Ycf53, N-terminal domain {Thermosynechococcus elongatus [TaxId: 146786]}
mvttepaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppapwir
gqayrllfhspeasvqaflqqhypqgv

Sequence, based on observed residues (ATOM records):

>d1z3xa1 a.118.1.22 (A:1-87) GUN4-like protein Ycf53, N-terminal domain {Thermosynechococcus elongatus [TaxId: 146786]}
mvtpaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppapwirgq
ayrllfhspeasvqaflqqhypqgv

Timeline for d1z3xa1:

• d1z3xa1 is new in SCOP 1.73
  
• d1z3xa1 appears in SCOP 1.75
  
• d1z3xa1 appears in the current release, SCOPe 2.08