Lineage for d1z3va_ (1z3v A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2779997Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [186898] (3 PDB entries)
  8. 2779998Domain d1z3va_: 1z3v A: [124414]
    automated match to d1gpia_
    complexed with nag

Details for d1z3va_

PDB Entry: 1z3v (more details), 1.61 Å

PDB Description: structure of phanerochaete chrysosporium cellobiohydrolase cel7d (cbh58) in complex with lactose
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d1z3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3va_ b.29.1.10 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
eqagtntaenhpqlqsqqcttsggckplstkvvldsnwrwvhstsgytncytgnewdtsl
cpdgktcaancaldgadysgtygitstgtaltlkfvtgsnvgsrvylmaddthyqllkll
nqeftfdvdmsnlpcglngalylsamdadggmskypgnkagakygtgycdsqcpkdikfi
ngeanvgnwtetgsntgtgsygtccsemdiweanndaaaftphpctttgqtrcsgddcar
ntglcdgdgcdfnsfrmgdktflgkgmtvdtskpftvvtqfltndntstgtlseirriyi
qngkviqnsvanipgvdpvnsitdnfcaqqktafgdtnwfaqkgglkqmgealgngmvla
lsiwddhaanmlwldsdyptdkdpsapgvargtcattsgvpsdvesqvpnsqvvfsnikf
gdigstfsgts

SCOPe Domain Coordinates for d1z3va_:

Click to download the PDB-style file with coordinates for d1z3va_.
(The format of our PDB-style files is described here.)

Timeline for d1z3va_: