Lineage for d1z3ta_ (1z3t A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781267Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 1781325Protein automated matches [190170] (12 species)
    not a true protein
  7. 1781326Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [186898] (3 PDB entries)
  8. 1781328Domain d1z3ta_: 1z3t A: [124413]
    automated match to d1gpia_
    complexed with cbi, nag

Details for d1z3ta_

PDB Entry: 1z3t (more details), 1.7 Å

PDB Description: structure of phanerochaete chrysosporium cellobiohydrolase cel7d (cbh58) in complex with cellobiose
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d1z3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3ta_ b.29.1.10 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
eqagtntaenhpqlqsqqcttsggckplstkvvldsnwrwvhstsgytncytgnewdtsl
cpdgktcaancaldgadysgtygitstgtaltlkfvtgsnvgsrvylmaddthyqllkll
nqeftfdvdmsnlpcglngalylsamdadggmskypgnkagakygtgycdsqcpkdikfi
ngeanvgnwtetgsntgtgsygtccsemdiweanndaaaftphpctttgqtrcsgddcar
ntglcdgdgcdfnsfrmgdktflgkgmtvdtskpftvvtqfltndntstgtlseirriyi
qngkviqnsvanipgvdpvnsitdnfcaqqktafgdtnwfaqkgglkqmgealgngmvla
lsiwddhaanmlwldsdyptdkdpsapgvargtcattsgvpsdvesqvpnsqvvfsnikf
gdigstfsgts

SCOPe Domain Coordinates for d1z3ta_:

Click to download the PDB-style file with coordinates for d1z3ta_.
(The format of our PDB-style files is described here.)

Timeline for d1z3ta_: