Lineage for d1z3ix2 (1z3i X:92-389)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 989960Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 990096Protein Rad54-like, Rad54L [142316] (1 species)
  7. 990097Species Zebrafish (Danio rerio) [TaxId:7955] [142317] (1 PDB entry)
    Uniprot Q7ZV09 390-735! Uniprot Q7ZV09 92-389
  8. 990099Domain d1z3ix2: 1z3i X:92-389 [124407]
    protein/DNA complex; complexed with so4, zn

Details for d1z3ix2

PDB Entry: 1z3i (more details), 3 Å

PDB Description: Structure of the SWI2/SNF2 chromatin remodeling domain of eukaryotic Rad54
PDB Compounds: (X:) similar to RAD54-like

SCOPe Domain Sequences for d1z3ix2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebrafish (Danio rerio) [TaxId: 7955]}
lglrragvrkalhdpfedgalvlyeppaisahdlikadkeklpvhvvvdpvlskvlrphq
regvkflwdcvtgrriensygcimademglgktlqcitliwtllkqspdckpeidkvivv
spsslvrnwynevgkwlggrvqpvaidggskdeidsklvnfisqqgmriptpiliisyet
frlhaevlhkgkvglvicdeghrlknsdnqtylalnsmnaqrrvlisgtpiqndlleyfs
lvhfvnsgilgtaqefkkrfeipilkgrdadasdkdraageqklqelisivnrclirr

SCOPe Domain Coordinates for d1z3ix2:

Click to download the PDB-style file with coordinates for d1z3ix2.
(The format of our PDB-style files is described here.)

Timeline for d1z3ix2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z3ix1