SCOPe 2.01: Domain d1z3ix1: 1z3i X:390-735

Lineage for d1z3ix1 (1z3i X:390-735)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Rad54-like, Rad54L [142316] (1 species)

7. Species Zebrafish (Danio rerio) [TaxId:7955] [142317] (1 PDB entry)
   Uniprot Q7ZV09 390-735! Uniprot Q7ZV09 92-389

8. Domain d1z3ix1: 1z3i X:390-735 [124406]
   protein/DNA complex; complexed with so4, zn

Details for d1z3ix1

PDB Entry: 1z3i, 3 Å

PDB Description: Structure of the SWI2/SNF2 chromatin remodeling domain of eukaryotic Rad54

PDB Compounds: (X:) similar to RAD54-like

SCOPe Domain Sequences for d1z3ix1:

Sequence; same for both SEQRES and ATOM records:

>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebrafish (Danio rerio) [TaxId: 7955]}
tsdilskylpvkieqvvccnltplqkelyklflkqakpveslqtgkisvsslssitslkk
lcnhpaliyekcltgeegfdgaldlfpqnystkavepqlsgkmlvldyilamtrtttsdk
vvlvsnytqtldlfeklcrnrrylyvrldgtmsikkrakiverfnnpsspefifmlsska
ggcglnliganrlvmfdpdwnpandeqamarvwrdgqkktcyiyrllstgtieekilqrq
ahkkalsscvvdeeqdverhfslgelrelfslnektlsdthdrfrcrrcvngrqvrpppd
dsdctcdlsnwhhcadkrglrdpvlqaswdaavsfvfhqrshedqr

Timeline for d1z3ix1:

• d1z3ix1 first appeared in SCOP 1.73
  
• d1z3ix1 appears in SCOP 1.75
  
• d1z3ix1 appears in SCOPe 2.02
  
• d1z3ix1 appears in the current release, SCOPe 2.08