![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (23 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Rad54-like, Rad54L [142316] (1 species) |
![]() | Species Zebra fish (Danio rerio) [TaxId:7955] [142317] (1 PDB entry) Uniprot Q7ZV09 390-735! Uniprot Q7ZV09 92-389 |
![]() | Domain d1z3ix1: 1z3i X:390-735 [124406] complexed with so4, zn |
PDB Entry: 1z3i (more details), 3 Å
SCOP Domain Sequences for d1z3ix1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} tsdilskylpvkieqvvccnltplqkelyklflkqakpveslqtgkisvsslssitslkk lcnhpaliyekcltgeegfdgaldlfpqnystkavepqlsgkmlvldyilamtrtttsdk vvlvsnytqtldlfeklcrnrrylyvrldgtmsikkrakiverfnnpsspefifmlsska ggcglnliganrlvmfdpdwnpandeqamarvwrdgqkktcyiyrllstgtieekilqrq ahkkalsscvvdeeqdverhfslgelrelfslnektlsdthdrfrcrrcvngrqvrpppd dsdctcdlsnwhhcadkrglrdpvlqaswdaavsfvfhqrshedqr
Timeline for d1z3ix1: