Lineage for d1z3ha1 (1z3h A:2-959)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775278Family a.118.1.1: Armadillo repeat [48372] (6 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 775305Protein Exportin Cse1p [116998] (1 species)
  7. 775306Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116999] (2 PDB entries)
    Uniprot P33307
  8. 775308Domain d1z3ha1: 1z3h A:2-959 [124404]
    complexed with mg

Details for d1z3ha1

PDB Entry: 1z3h (more details), 3.1 Å

PDB Description: The exportin Cse1 in its cargo-free, cytoplasmic state
PDB Compounds: (A:) importin alpha re-exporter

SCOP Domain Sequences for d1z3ha1:

Sequence, based on SEQRES records: (download)

>d1z3ha1 a.118.1.1 (A:2-959) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalff
knfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdrw
ptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapflnl
lktvdeqitanennkaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkyls
ysnplledpdetehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsisn
qpkydilvskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfeddp
ieyirrdlegsdtdtrrractdflkelkeknevlvtniflahmkgfvdqymsdpsknwkf
kdlyiylftalaingnitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaiky
iytfrnqltkaqlielmpilatflqtdeyvvytyaaitiekiltiresntspafifhked
isnsteillknlialilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfie
ivtimaknpsnprfthytfesigailnytqrqnlpllvdsmmptfltvfsediqefipyv
fqiiafvveqsatipesikplaqpllapnvwelkgnipavtrllksfiktdssifpdlvp
vlgifqrliaskayevhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvkk
ltvffglisnklgsdflihfidevqdglfqqiwgnfiittlptignlldrkialigvlnm
vingqffqskyptlisstmnsiietassqsianlkndyvdldnleeistfgshfsklvsi
sekpfdplpeidvnngvrlyvaealnkynaisgntflntilpqltqenqvklnqllvg

Sequence, based on observed residues (ATOM records): (download)

>d1z3ha1 a.118.1.1 (A:2-959) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalff
knfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdrw
ptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapflnl
lktvdeqitanennkaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkyls
ysnplledpdetehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsisn
qpkydilvskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfeddp
ieyirrdlegsdtdtrrractdflkelkeknevlvtniflahmkgfvdqymsdpsknwkf
kdlyiylftalaingnitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaiky
iytfrnqltkaqlielmpilatflqtdeyvvytyaaitiekiltiressnsteillknli
alilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfieivtimaknpsnpr
fthytfesigailnytqrqnlpllvdsmmptfltvfsediqefipyvfqiiafvveqsat
ipesikplaqpllapnvwelkgnipavtrllksfiktdssifpdlvpvlgifqrliaska
yevhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvkkltvffglisnklg
sdflihfidevqdglfqqiwgnfiittlptignlldrkialigvlnmvingqffqskypt
lisstmnsiietassqsgshfsklvsisekpfdplpeidvnngvrlyvaealnkynaisg
ntflntilpqltqenqvklnqllvg

SCOP Domain Coordinates for d1z3ha1:

Click to download the PDB-style file with coordinates for d1z3ha1.
(The format of our PDB-style files is described here.)

Timeline for d1z3ha1: