SCOPe 2.08: Domain d1z3eb1: 1z3e B:245-311

Lineage for d1z3eb1 (1z3e B:245-311)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)

6. Protein C-terminal domain of RNA polymerase alpha subunit [47791] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [140637] (1 PDB entry)
   Uniprot P20429 245-311

8. Domain d1z3eb1: 1z3e B:245-311 [124401]
   Other proteins in same PDB: d1z3ea1, d1z3ea2
   protein/RNA complex; complexed with so4

Details for d1z3eb1

PDB Entry: 1z3e, 1.5 Å

PDB Description: crystal structure of spx in complex with the c-terminal domain of the rna polymerase alpha subunit

PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1z3eb1:

Sequence; same for both SEQRES and ATOM records:

>d1z3eb1 a.60.3.1 (B:245-311) C-terminal domain of RNA polymerase alpha subunit {Bacillus subtilis [TaxId: 1423]}
kekvlemtieeldlsvrsynclkragintvqelankteedmmkvrnlgrksleevkakle
elglglr

Timeline for d1z3eb1:

• d1z3eb1 first appeared in SCOP 1.73
  
• d1z3eb1 appears in SCOPe 2.07