SCOPe 2.08: Domain d1z3ab_: 1z3a B:

Lineage for d1z3ab_ (1z3a B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein tRNA adenosine deaminase TadA [142840] (3 species)

7. Species Escherichia coli [TaxId:562] [142842] (1 PDB entry)
   Uniprot P68398 13-168

8. Domain d1z3ab_: 1z3a B: [124397]
   automated match to d1z3aa1
   complexed with zn

Details for d1z3ab_

PDB Entry: 1z3a, 2.03 Å

PDB Description: crystal structure of trna adenosine deaminase tada from escherichia coli

PDB Compounds: (B:) tRNA-specific adenosine deaminase

SCOPe Domain Sequences for d1z3ab_:

Sequence; same for both SEQRES and ATOM records:

>d1z3ab_ c.97.1.2 (B:) tRNA adenosine deaminase TadA {Escherichia coli [TaxId: 562]}
sevefsheywmrhaltlakrawderevpvgavlvhnnrvigegwnrpigrhdptahaeim
alrqgglvmqnyrlidatlyvtlepcvmcagamihsrigrvvfgardaktgaagslmdvl
hhpgmnhrveitegiladecaallsdffrmrrqeik

Timeline for d1z3ab_:

• d1z3ab_ first appeared in SCOP 1.73, called d1z3ab1
  
• d1z3ab_ appears in SCOPe 2.07