Lineage for d1z2ua1 (1z2u A:1-147)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2183823Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2183831Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 2183864Species Caenorhabditis elegans, E2 2 [TaxId:6239] [143060] (1 PDB entry)
    Uniprot P35129 1-147
  8. 2183865Domain d1z2ua1: 1z2u A:1-147 [124389]
    Other proteins in same PDB: d1z2ua2
    complexed with bu3, cl, na, unx

Details for d1z2ua1

PDB Entry: 1z2u (more details), 1.1 Å

PDB Description: the 1.1a crystallographic structure of ubiquitin-conjugating enzyme (ubc-2) from caenorhabditis elegans: functional and evolutionary significance
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 2

SCOPe Domain Sequences for d1z2ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]}
malkriqkelqdlgrdppaqcsagpvgddlfhwqatimgppespyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrerynqlarewtqkyam

SCOPe Domain Coordinates for d1z2ua1:

Click to download the PDB-style file with coordinates for d1z2ua1.
(The format of our PDB-style files is described here.)

Timeline for d1z2ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z2ua2