Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Caenorhabditis elegans, E2 2 [TaxId:6239] [143060] (1 PDB entry) Uniprot P35129 1-147 |
Domain d1z2ua1: 1z2u A:1-147 [124389] complexed with bu3, cl, na, unx |
PDB Entry: 1z2u (more details), 1.1 Å
SCOPe Domain Sequences for d1z2ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} malkriqkelqdlgrdppaqcsagpvgddlfhwqatimgppespyqggvffltihfptdy pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv peiariyktdrerynqlarewtqkyam
Timeline for d1z2ua1: