![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) ![]() |
![]() | Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) |
![]() | Protein Allantoate amidohydrolase AllC [143401] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [143402] (2 PDB entries) Uniprot P77425 211-327 |
![]() | Domain d1z2lb2: 1z2l B:213-329 [124386] Other proteins in same PDB: d1z2la1, d1z2la3, d1z2lb1, d1z2lb3 automated match to d1z2la2 complexed with 1al, so4, zn |
PDB Entry: 1z2l (more details), 2.25 Å
SCOPe Domain Sequences for d1z2lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2lb2 d.58.19.1 (B:213-329) Allantoate amidohydrolase AllC {Escherichia coli [TaxId: 562]} vgqrrytvtlngesnhagttpmgyrrdtvyafsrichqsvekakrmgdplvltfgkvepr pntvnvvpgkttftidcrhtdaavlrdftqqlendmraicdemdigididlwmdeep
Timeline for d1z2lb2: