SCOPe 2.05: Domain d1z2lb2: 1z2l B:213-329

Lineage for d1z2lb2 (1z2l B:213-329)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family)

5. Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)

6. Protein Allantoate amidohydrolase AllC [143401] (1 species)

7. Species Escherichia coli [TaxId:562] [143402] (2 PDB entries)
   Uniprot P77425 211-327

8. Domain d1z2lb2: 1z2l B:213-329 [124386]
   Other proteins in same PDB: d1z2la1, d1z2lb1
   automated match to d1z2la2
   complexed with 1al, so4, zn

Details for d1z2lb2

PDB Entry: 1z2l, 2.25 Å

PDB Description: crystal structure of allantoate-amidohydrolase from e.coli k12 in complex with substrate allantoate

PDB Compounds: (B:) Allantoate amidohydrolase

SCOPe Domain Sequences for d1z2lb2:

Sequence; same for both SEQRES and ATOM records:

>d1z2lb2 d.58.19.1 (B:213-329) Allantoate amidohydrolase AllC {Escherichia coli [TaxId: 562]}
vgqrrytvtlngesnhagttpmgyrrdtvyafsrichqsvekakrmgdplvltfgkvepr
pntvnvvpgkttftidcrhtdaavlrdftqqlendmraicdemdigididlwmdeep

Timeline for d1z2lb2:

• d1z2lb2 first appeared in SCOP 1.73
  
• d1z2lb2 appears in SCOPe 2.04
  
• d1z2lb2 appears in SCOPe 2.06
  
• d1z2lb2 appears in the current release, SCOPe 2.08