Lineage for d1z2lb2 (1z2l B:213-329)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863383Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 863384Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)
  6. 863385Protein Allantoate amidohydrolase AllC [143401] (1 species)
  7. 863386Species Escherichia coli [TaxId:562] [143402] (2 PDB entries)
    Uniprot P77425 211-327
  8. 863388Domain d1z2lb2: 1z2l B:213-329 [124386]
    Other proteins in same PDB: d1z2la1, d1z2lb1
    automatically matched to 1Z2L A:213-329
    complexed with 1al, so4, zn

Details for d1z2lb2

PDB Entry: 1z2l (more details), 2.25 Å

PDB Description: crystal structure of allantoate-amidohydrolase from e.coli k12 in complex with substrate allantoate
PDB Compounds: (B:) Allantoate amidohydrolase

SCOP Domain Sequences for d1z2lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2lb2 d.58.19.1 (B:213-329) Allantoate amidohydrolase AllC {Escherichia coli [TaxId: 562]}
vgqrrytvtlngesnhagttpmgyrrdtvyafsrichqsvekakrmgdplvltfgkvepr
pntvnvvpgkttftidcrhtdaavlrdftqqlendmraicdemdigididlwmdeep

SCOP Domain Coordinates for d1z2lb2:

Click to download the PDB-style file with coordinates for d1z2lb2.
(The format of our PDB-style files is described here.)

Timeline for d1z2lb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z2lb1