Lineage for d1z2lb1 (1z2l B:4-212,B:330-412)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2126919Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 protein domains)
  6. 2126920Protein Allantoate amidohydrolase AllC catalytic domain [142514] (1 species)
  7. 2126921Species Escherichia coli [TaxId:562] [142515] (2 PDB entries)
    Uniprot P77425 2-210,328-411
  8. 2126923Domain d1z2lb1: 1z2l B:4-212,B:330-412 [124385]
    Other proteins in same PDB: d1z2la2, d1z2la3, d1z2lb2, d1z2lb3
    automated match to d1z2la1
    complexed with 1al, so4, zn

Details for d1z2lb1

PDB Entry: 1z2l (more details), 2.25 Å

PDB Description: Crystal structure of Allantoate-amidohydrolase from E.coli K12 in complex with substrate Allantoate
PDB Compounds: (B:) Allantoate amidohydrolase

SCOPe Domain Sequences for d1z2lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2lb1 c.56.5.4 (B:4-212,B:330-412) Allantoate amidohydrolase AllC catalytic domain {Escherichia coli [TaxId: 562]}
ithfrqaieetlpwlssfgadpaggmtrllyspewletqqqfkkrmaasgletrfdevgn
lygrlngteypqevvlsgshidtvvnggnldgqfgalaawlaidwlktqygaplrtvevv
amaeeegsrfpyvfwgsknifglanpddvrnicdakgnsfvdamkacgftlpnapltprq
dikafvelhieqgcvlesngqsigvvnaiXvpmnkelvatltelcereklnyrvmhsgag
hdaqifaprvptcmifipsingishnpaertnitdlaegvktlalmlyqlawq

SCOPe Domain Coordinates for d1z2lb1:

Click to download the PDB-style file with coordinates for d1z2lb1.
(The format of our PDB-style files is described here.)

Timeline for d1z2lb1: