SCOP 1.73: Domain d1z2ea1: 1z2e A:3-139

Lineage for d1z2ea1 (1z2e A:3-139)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)

6. Protein Arsenate reductase ArsC [69504] (3 species)
   also has a phosphotyrosine phosphatase activity

7. Species Bacillus subtilis [TaxId:1423] [69506] (3 PDB entries)

8. Domain d1z2ea1: 1z2e A:3-139 [124381]
   automatically matched to d1jl3a_

Details for d1z2ea1

PDB Entry: 1z2e

PDB Description: solution structure of bacillus subtilis arsc in oxidized state

PDB Compounds: (A:) arsenate reductase

SCOP Domain Sequences for d1z2ea1:

Sequence; same for both SEQRES and ATOM records:

>d1z2ea1 c.44.1.1 (A:3-139) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]}
nkiiyflctgnscrsqmaegwakqylgdewkvysagieahglnpnavkamkevgidisnq
tsdiidsdilnnadlvvtlcgdaadkcpmtpphvkrehwgfddparaqgteeekwaffqr
vrdeignrlkefaetgk

Timeline for d1z2ea1:

• d1z2ea1 is new in SCOP 1.73
  
• d1z2ea1 appears in SCOP 1.75
  
• d1z2ea1 appears in the current release, SCOPe 2.08, called d1z2ea_