| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) ![]() share the common active site structure with the family II |
| Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins) |
| Protein Arsenate reductase ArsC [69504] (3 species) also has a phosphotyrosine phosphatase activity |
| Species Bacillus subtilis [TaxId:1423] [69506] (3 PDB entries) |
| Domain d1z2ea1: 1z2e A:3-139 [124381] automatically matched to d1jl3a_ |
PDB Entry: 1z2e (more details)
SCOP Domain Sequences for d1z2ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2ea1 c.44.1.1 (A:3-139) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]}
nkiiyflctgnscrsqmaegwakqylgdewkvysagieahglnpnavkamkevgidisnq
tsdiidsdilnnadlvvtlcgdaadkcpmtpphvkrehwgfddparaqgteeekwaffqr
vrdeignrlkefaetgk
Timeline for d1z2ea1: