![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) ![]() share the common active site structure with the family II |
![]() | Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins) automatically mapped to Pfam PF01451 |
![]() | Protein Arsenate reductase ArsC [69504] (3 species) also has a phosphotyrosine phosphatase activity |
![]() | Species Bacillus subtilis [TaxId:1423] [69506] (3 PDB entries) |
![]() | Domain d1z2ea_: 1z2e A: [124381] automated match to d1jl3a_ |
PDB Entry: 1z2e (more details)
SCOPe Domain Sequences for d1z2ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2ea_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]} menkiiyflctgnscrsqmaegwakqylgdewkvysagieahglnpnavkamkevgidis nqtsdiidsdilnnadlvvtlcgdaadkcpmtpphvkrehwgfddparaqgteeekwaff qrvrdeignrlkefaetgk
Timeline for d1z2ea_: