Lineage for d1z2da_ (1z2d A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130626Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2130627Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2130628Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2130629Protein Arsenate reductase ArsC [69504] (3 species)
    also has a phosphotyrosine phosphatase activity
  7. 2130635Species Bacillus subtilis [TaxId:1423] [69506] (3 PDB entries)
  8. 2130641Domain d1z2da_: 1z2d A: [124380]
    automated match to d1jl3a_

Details for d1z2da_

PDB Entry: 1z2d (more details)

PDB Description: solution structure of bacillus subtilis arsc in reduced state
PDB Compounds: (A:) arsenate reductase

SCOPe Domain Sequences for d1z2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2da_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]}
menkiiyflctgnscrsqmaegwakqylgdewkvysagieahglnpnavkamkevgidis
nqtsdiidsdilnnadlvvtlcgdaadkcpmtpphvkrehwgfddparaqgteeekwaff
qrvrdeignrlkefaetgk

SCOPe Domain Coordinates for d1z2da_:

Click to download the PDB-style file with coordinates for d1z2da_.
(The format of our PDB-style files is described here.)

Timeline for d1z2da_: