Lineage for d1z2cb1 (1z2c B:83-443)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 646821Superfamily a.118.1: ARM repeat [48371] (22 families) (S)
  5. 647094Family a.118.1.23: Diap1 N-terninal region-like [140830] (1 protein)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam 06367
    this is a repeat family; one repeat unit is 2bap A:217-262 found in domain
  6. 647095Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. 647096Species Mouse (Mus musculus) [TaxId:10090] [140832] (3 PDB entries)
  8. 647099Domain d1z2cb1: 1z2c B:83-443 [124377]
    Other proteins in same PDB: d1z2ca1, d1z2cc1
    complexed with gnp, mg; mutant

Details for d1z2cb1

PDB Entry: 1z2c (more details), 3 Å

PDB Description: crystal structure of mdia1 gbd-fh3 in complex with rhoc-gmppnp
PDB Compounds: (B:) Diaphanous protein homolog 1

SCOP Domain Sequences for d1z2cb1:

Sequence, based on SEQRES records: (download)

>d1z2cb1 a.118.1.23 (B:83-443) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtskagmnqkessrsammyiqe
lrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdekeetsgnyds
rnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakllsalcilpq
pedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalitpaeeldfr
vhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddirmemddfg
evfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlhkngtdpd
f

Sequence, based on observed residues (ATOM records): (download)

>d1z2cb1 a.118.1.23 (B:83-443) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtsssrsammyiqelrsglrdm
hllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdekdsrnqheiirclkafmn
nkfgiktmleteegilllvramdpavpnmmidaakllsalcilpqpedmnervleamter
aemdeverfqplldglksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqv
lqelreienedmkvqlcvfdeqgdedffdlkgrlddirmemddfgevfqiilntvkdska
ephflsilqhlllvrndyearpqyyklieecvsqivlhkngtdpdf

SCOP Domain Coordinates for d1z2cb1:

Click to download the PDB-style file with coordinates for d1z2cb1.
(The format of our PDB-style files is described here.)

Timeline for d1z2cb1: